SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SJAG_01585T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_01585T0
Domain Number 1 Region: 293-367
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000517
Family UBX domain 0.044
Further Details:      
 
Domain Number 2 Region: 102-217
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000047
Family DsbC/DsbG C-terminal domain-like 0.081
Further Details:      
 
Weak hits

Sequence:  SJAG_01585T0
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily UBA-like 0.00168
Family TAP-C domain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SJAG_01585T0
Sequence length 444
Comment | SJAG_01585 | Schizosaccharomyces japonicus yFS275 UBA/UAS domain-containing protein Ucp10 (445 aa)
Sequence
MSLQTHESAIRELQRVCEVPDDTAEALLSSCDWDVQRAIETISSTSERPKDNKTSSKTFR
FGVLQTLFSLFVSGMQRLFAFLSRVPLVNNFLPFLQQKKRITSPADASNAFIQRLEEQYG
TAHIKLYDNGGYKEALVQAKKEYGIALLLFTSSEHESADVFASKVLMNPELHTFLLRHKI
ICWAGDVCEEEAYFAACQFGCGHFPAAVLTIYSPRHSDLLVTASMSGVLSAESLMTTITN
AFVRYLPPLERLHNSLAEQNAARELRAEQDRAYNESLAADRKRQTQARLQRERELAMQRQ
KRETEAKDRAFRSYIRSQWIEPATPSASDTARISIRLPDGNRVIRVFSKSALIRELYDYA
DAYYYKETDAQASVDEDEEYLRNFNVKTYPYEHSCRVYTLMPRVLLDPSTVIESNKYIYP
NGNVVVEFADEEDDSEEEEDDATN
Download sequence
Identical sequences B6JYC5
SJAG_01585T0 XP_002172836.1.46972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]