SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SJAG_02017T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_02017T0
Domain Number 1 Region: 248-406
Classification Level Classification E-value
Superfamily eEF1-gamma domain 9.94e-61
Family eEF1-gamma domain 0.000022
Further Details:      
 
Domain Number 2 Region: 72-194
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.46e-27
Family Glutathione S-transferase (GST), C-terminal domain 0.0031
Further Details:      
 
Domain Number 3 Region: 1-77
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000177
Family Glutathione S-transferase (GST), N-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SJAG_02017T0
Sequence length 406
Comment | SJAG_02017 | Schizosaccharomyces japonicus yFS275 translation elongation factor EF-1 gamma subunit (407 aa)
Sequence
MSFGTIYGIQGSFRVDAVVLAAQKSGVKVDVVNVFPHQFPEDIAAKFPQQKSPAFLGADG
FALTETIAIAIYLASQAPNAPILGTTEKARAKALQWASFANSELIRAFAQWMLGRHGILP
YNAAAEKESKQQTFALFDFLNKELADKTYLAGDRLTIGDIFVASFLNALFRTVFTKAELA
KYGNVQRYFTTMYYQTGLDSLHGELTIVDTSIPVPKVEKPKAEKPKAQKKAAAEKPKPAA
AEQAAPKPKHPLAGLPNGNFNIEEFKRVYSNKDTRGEALPYFFDHFDPENYSVWKIDYAF
PDDLKQPVFMTNNLIGGFFQRLQASLKFIFGCCVVIGENGDNTITGAFVIKGQDHVPAFD
VAPDWESYTFTKLDASKPEDKAFIEDAWAWDKPIAGREVADGKVCK
Download sequence
Identical sequences B6JZH7
SJAG_02017T0 XP_002173238.1.46972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]