SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SJAG_04539T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_04539T0
Domain Number 1 Region: 120-274
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-40
Family Hypothetical protein AT3g04780/F7O18 27 0.0003
Further Details:      
 
Domain Number 2 Region: 2-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.71e-29
Family Thioltransferase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SJAG_04539T0
Sequence length 289
Comment | SJAG_04539 | Schizosaccharomyces japonicus yFS275 thioredoxin-like I protein Txl1 (290 aa)
Sequence
MSVVEVSSYQHWTSIMPKNGFLAVDCYADWCQPCRAISPVFEQLAKRYASKSFVFAKINV
DNQQQVASSLNVRSMPTFLFFENGRQVDMLVGANRDALMKKVEALAKRSNGLTGDSSIPA
ALVARGFTNLASMIEKRQLECLNQDDDHPLIGLFNGKGNYLESDVDEQLMIYIPFLEAVK
IHSIAITPTEDISYAPAAMKLFINLPNVLSFEDADSLEATQEFTEIKYDKANEPVVVPLR
FVKFQRVNSLVIFISKNVGDEDTTRLANLQLIGEPVGGSSNGKLTKIDD
Download sequence
Identical sequences SJAG_04539T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]