SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|399545497|ref|YP_006558805.1| from Marinobacter sp. BSs20148

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|399545497|ref|YP_006558805.1|
Domain Number 1 Region: 551-1041
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-125
Family ALDH-like 0.000000485
Further Details:      
 
Domain Number 2 Region: 190-535
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.22e-113
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000445
Further Details:      
 
Domain Number 3 Region: 18-189
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.31e-62
Family N-terminal domain of bifunctional PutA protein 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|399545497|ref|YP_006558805.1|
Sequence length 1059
Comment bifunctional protein putA [Marinobacter sp. BSs20148]
Sequence
MFRASKVLEPAFQEQPRSFFWQGLTENYQVDEAAYLKELIPLAQSDASEHKAITDTASSL
IGKVRAQDGAVHMIDALLQEYSLDTEEGILLMCLAEALMRIPDKHTADALIRDKMLSADW
KKHVGRSESTLVNASTWGLMLTGRVVKMDKRLDGSPSNVWNRLVKRSGEPVIRGAMNQAM
AIMGKQFVLGRDITEALKQARDDRKMGYSYSFDMLGEAAMAQDDADLYLKEYLQAIEAVG
NDPDPQNNAPRLSISIKLSALHPRYEVSQEHRVLTELYRTVCDLVQFARDRDVSITIDAE
EMDRLELSLKLFEKILTSPAASGWGGFGLVIQAYSKRALPALCWLTKLAKETGDEIPIRL
VKGAYWDTEIKMCQQMGIESYPVFTRKEATDTSYLACLRFLLSDYTQGALYPQLASHNAH
TVAAVLAMAKKRNRKIEFQRLHGMGDALYNSILQEHDIPVRIYAPVGAHKDLLPYLVRRL
LENGANSSFVHRLVDASTPIEHLVQNPVQELQKYDSLANSRIPRPMDIFGEQRRNSRGIN
IHVASQLEPLINNLQKWNSARWHACPVINGERRSDGDKTEVRAPYDRSKRVGDVVWANEK
HAEDALKVAFAGFRKWNERPVEERALCLEKFANLMEKHMEELMALCCQEAGKTMQDGIDE
VREAVDFCRYYANDGRARFAKAIALPGPTGESNELYMEGRGVFLCISPWNFPLAIYTGQI
MAALVAGNTVIAKPAEQTSLVAMRGMELMLEAGFPANVLQFLPGDGAKLGKVLTPDSRIA
GVCFTGSTLVAHFLNRTLAQRSGAIVPLIAETGGQNAMIVDSSALPEQVVRDVVQSAFAS
AGQRCSALRVLYVQQDVADRMETLLAGAMNELVVGNPQSHSTDVGPVIDQKAKENLEKHL
VNLEANARLIGRKELPSDCSAGYFVVPSAYGINSINDLDGEHFGPILHVIRYEAEQLDNV
IDEINTTGYGLTLGIHSRSESTAAYIERRVKVGNCYVNRNQIGAVVGVQPFGGRGLSGTG
PKAGGPHYVLRFATERTRTINTTAVGGNASLLSLGIEQV
Download sequence
Identical sequences M1FGI2
WP_014871744.1.23067 gi|399545497|ref|YP_006558805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]