SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|399545942|ref|YP_006559250.1| from Marinobacter sp. BSs20148

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|399545942|ref|YP_006559250.1|
Domain Number 1 Region: 549-1009
Classification Level Classification E-value
Superfamily ALDH-like 3.8e-124
Family ALDH-like 0.000000253
Further Details:      
 
Domain Number 2 Region: 181-524
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 9.42e-110
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000173
Further Details:      
 
Domain Number 3 Region: 15-180
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 4.97e-52
Family N-terminal domain of bifunctional PutA protein 0.0000758
Further Details:      
 
Weak hits

Sequence:  gi|399545942|ref|YP_006559250.1|
Domain Number - Region: 1085-1141
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00192
Family L-arabinose binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|399545942|ref|YP_006559250.1|
Sequence length 1209
Comment bifunctional protein putA [Marinobacter sp. BSs20148]
Sequence
MRPQQSETPAVVDSRQAIRDYNLAFEHVVVHEMIVGAQLSPSESKAISARAADLVRGVRK
NAKPTIMEKFLAEYGLTTKEGIALMCLAEAMLRVPDATTINDLIEDKITSGCWGDHVGRA
SSSLINTATIALLMTSNLLKDSERKNVGETLRKLLKRLGEPVIRTVAGQAMKEMGRQFVL
GRDIKEAQSAGEGYMKKGYTYSYDMLGEAARTDHDAQRYYNAYSDGIDSIAKHCSGDVRK
NPGISVKLSALLARYEYGNKERVMKELVPRAMRLVKKAAAANMGFNIDAEEQDRLELSMD
VIEALLSDPELAGWNGFGVVVQAYGKRAPFMLDWLYGIAKKYDRRIMVRLVKGAYWDAEI
KRAQVMGLDGFPVFTRKACTDVSFLSCSTKLMNMTDRIYPQFATHNAHSVSAILELARVR
GEANFEFQRLHGMGESLHSQVMGDSGVPCRIYAPVGPHHELLAYLVRRLLENGANSSFVN
QIVDEDISPEMIAKDPIDLVKEMGDDISSKAIVRPARLFGENRRNSKGWDLTDSVTIEAI
DKGRDAYREHHWNGGPLIAGEVSGTEVQVVRNPANPEDLVGHVTQANEADIETAISAAQK
GFKSWSATPAEERAACLRRVADLYEENTLELFALATREAGKSLSDAVAEIREAVDFAHYY
ANEGVRYENSGEAIGPVVCISPWNFPLAIFTGQILANLVVGNVVLAKPAEQTSLLAARAV
ELMHEAGIPKDAIQLVPGTGATVGAGLTSDSRIAGVCFTGSTNTAKIIDKAMAENMAPDA
VLVAETGGLNAMIVDSTALPEQVVRDVLASSFQSAGQRCSALRMLYVQKDIADSLLKMLF
GAMEELGIGDPWILSTDVGPVIDEPSAKKIIDHCKKFENKNQLLKKLSVPHKGNFVSPAV
IKVNGIADLEEEIFGPVLHVATFDAKDIDKVVDDINAKGYGLTFGVHSRVDSRIDRISRR
IKVGNIYVNRNQIGAVVGSQPFGGEGLSGTGPKAGGPQYVRRFMKGETVQRPAESGGKKV
DARALESLIGKLGRMNTQAPKARVEAMQSVFDSVPEPLDAHEEVMPGPTGESNILTNHAR
GTVLCLGPDKETAIEQMVMALAQGNKAVVVAPGVSDTVDRAAKAGLPVVGVEGQLEPDAL
ETVKGFEAVTSCGEHSVLKPYRQALRKRDGALLPLITEHKLDQRYVIERHLCIDTTAAGG
NASLIAASE
Download sequence
Identical sequences M1FHL2
gi|399545942|ref|YP_006559250.1| WP_014872185.1.23067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]