SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347522720|ref|YP_004780290.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347522720|ref|YP_004780290.1|
Domain Number 1 Region: 326-437
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.000000000000504
Family Pseudouridine synthase II TruB 0.0031
Further Details:      
 
Weak hits

Sequence:  gi|347522720|ref|YP_004780290.1|
Domain Number - Region: 164-199
Classification Level Classification E-value
Superfamily THUMP domain-like 0.000802
Family THUMP domain 0.044
Further Details:      
 
Domain Number - Region: 85-199
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0213
Family N-type ATP pyrophosphatases 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347522720|ref|YP_004780290.1|
Sequence length 478
Comment THUMP domain-containing protein [Pyrolobus fumarii 1A]
Sequence
MEGMEERVAHVASDIIVKSLQVLLEYPLCDRCLGRMFALLGKGWSNKQRGEAIKMIIIMV
LHRLAREGDEEASKLLERLSASLYNTAPRLYEELGVERTEIVCPLCGGVFDKVVNEVVER
AARLLREVEAESFVVGARLAEEVRGVEDSIVANYGLVHAESIAAELKREVGKRLRDLGFS
VDFSNPDVTLLVEYPSGRIEATINPILILGFYKKTARRVSQSSWITSFGVKRYPFSVQDA
YTPLLELYKGSEIVIHAAGREDVDVRMLGSGRPIVVEVKEPRRRRVKIEDAERSVNDEWV
GLFKTVLIERVTRSFMRSVVKGVEGEERHAKIYRALVYVPDGVSHEDIEKLVEFFKGRLV
RQRTPRRVRHRRADIIRERKVYEVSAYKISDNLFIAFIRAEGGLYIKELVSGEDTWPGFP
DALGKQAHCVELDVVKVETKLRVKEGLVSGAARGGVSNGKATQGLSPSHKEASTQTHP
Download sequence
Identical sequences G0EEJ7
gi|347522720|ref|YP_004780290.1| WP_014025715.1.63292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]