SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347522828|ref|YP_004780398.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|347522828|ref|YP_004780398.1|
Domain Number - Region: 70-131
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00258
Family GHMP Kinase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347522828|ref|YP_004780398.1|
Sequence length 293
Comment GHMP kinase [Pyrolobus fumarii 1A]
Sequence
MKCVEARVPLHLSIVWVPVVRGDPLHDGSLGAGLMLEPPVRALACNAPGGYHGPKIPPAL
RCLRSLGWNNEFIRVETPYPPGYGLAVSGAVTLAACLAYAGLRAISSIRAADEAHVAEVL
EGTGLGDVTALYTAWGLEVRVEPGAPGVGGRAEAHPVEELWAVAVPVRSVDTRVLLREMW
SRVTQDDAIHAYEAVRREPSLESLARAAREFTMRATPPPEAARRAIAECSSRAHLVVYKK
GSLVIIVDEPHNTIECLEKIGLRAILLRLTNTRPFTRWIDLRENVKQCSHTTC
Download sequence
Identical sequences G0EFA3
WP_014025823.1.63292 gi|347522828|ref|YP_004780398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]