SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347522927|ref|YP_004780497.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347522927|ref|YP_004780497.1|
Domain Number 1 Region: 40-268
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.69e-44
Family Phosphate binding protein-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347522927|ref|YP_004780497.1|
Sequence length 281
Comment molybdenum ABC transporter periplasmic molybdate-binding protein [Pyrolobus fumarii 1A]
Sequence
MKAPRFALVGLLVALGIVVLALTMVRSGYGTATETIVHKETIRVLLPAIAKKPWEEIVAS
FERDTGIHVEAAYGSTGWILSQLKVGHPADVVAVASIEDMEKAIRMGFVDPDSVKLIACT
VPAIIVPRGNPRNITCLEDLAKPGVRIAIADPETVVVGRYAKKLLEYNHLWDKVKPNIVT
YARNFADLVNTLITAKGRIDAIIAFHVAHYWYPNETELIWLPRSQVPCATCITIAVAKGG
DTALAEKFIEYVLGKGMEVFEKYHYMTPEEAEHHALKIGGC
Download sequence
Identical sequences G0EFS4
WP_014025922.1.63292 gi|347522927|ref|YP_004780497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]