SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347523439|ref|YP_004781009.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347523439|ref|YP_004781009.1|
Domain Number 1 Region: 10-145,180-389
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.13e-102
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000133
Further Details:      
 
Domain Number 2 Region: 393-572
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 9.91e-42
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000315
Further Details:      
 
Domain Number 3 Region: 146-180
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0000000000693
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347523439|ref|YP_004781009.1|
Sequence length 579
Comment methionyl-tRNA synthetase [Pyrolobus fumarii 1A]
Sequence
MLRGAAKVGRWVVTSAWPYVNSVPHLGNLVGSVLSADVFARYLRLRGEDVVFVSGSDEHG
TPIEIEAIKKGVQPRELTDQAHEYVSRLFREWRISFDNYTRTESETHKKFVREFFMKVYQ
NGYVFEQDEILPYCPRDKMFLPDRFVVGKCPYCGYEYARGDQCENCGRLLHPTMLKEPKC
AICGSKPEFRKTRHWFFDLPKLRDKVLKWLEESSLPDNVKNYSLNWVREGLKPRSITRDN
KWGIPAPFPGAEGKTIYVWFEALLGYISATIEYFEKKGEPERWKEYWFNQETKTVYFVGK
DNIPFHAIILPALLMASGEPYVLPYYISATEYLMYEGQQFSKSRRWGIWIDEALEILPVD
YWRFALIRMRPEAKDTNFSWEEFTRIINKELNDDIGNYVHRVLRFIEARFDSTIPEPGEL
NEIDKNFLETVREAPQRVAEEMDRFRLKLALERVLELARAGNQYLNAKAPWDAIKTNPRD
AATTMYLAANSIATLAILLAPFTPDAAERLWKMLNLPGSVHEKGRWKEAGTEILKPGHRI
GKVEPLFKKLPQDFPRRVTEMLQEVRKRVTEKRPPLLRA
Download sequence
Identical sequences G0EE63
WP_014026434.1.63292 gi|347523439|ref|YP_004781009.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]