SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347523507|ref|YP_004781077.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347523507|ref|YP_004781077.1|
Domain Number 1 Region: 124-220
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.05e-17
Family PDI-like 0.021
Further Details:      
 
Domain Number 2 Region: 10-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000642
Family PDI-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|347523507|ref|YP_004781077.1|
Sequence length 241
Comment glutaredoxin-like domain containing protein [Pyrolobus fumarii 1A]
Sequence
MKPVEVKFTSEDREALREALSDMENPVDIHVFIGPDCEYCNEAVELVKILVEESPEKNGQ
KLLRMHVWEKGKHDNVFKEHGVERIPSITLLDGVIRYTGVPAGEEVRGLVETIIRISTND
SGLDSSTVERIKRINKPVHIEVVVTPQCPYCPYAALLANMFAFEAWKAGRRDFIADTVEA
YENPDIAEKYGVTTVPAIAINGVLAFVGVPYEEDFIDRIERIVLRREKVDTEVIGESATG
L
Download sequence
Identical sequences G0EEK3
WP_014026502.1.63292 gi|347523507|ref|YP_004781077.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]