SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347523534|ref|YP_004781104.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347523534|ref|YP_004781104.1|
Domain Number 1 Region: 11-137
Classification Level Classification E-value
Superfamily Prefoldin 0.0000000000115
Family Prefoldin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347523534|ref|YP_004781104.1|
Sequence length 145
Comment prefoldin subunit alpha [Pyrolobus fumarii 1A]
Sequence
MSEQRIDVNTLLQQLSALEEYIAALQTSIERINASLQVLYAGEKALEELRNGDVEALVDL
DGGGVVYGFARINGGEKSKVLIHAGLDVFVEVPIDKALEIIRQRQAETAKTLDAYRRELM
NALGAYQQLRAMLEQAIRPAARQQG
Download sequence
Identical sequences G0EEN0
WP_014026529.1.63292 gi|347523534|ref|YP_004781104.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]