SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347523604|ref|YP_004781174.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347523604|ref|YP_004781174.1|
Domain Number 1 Region: 14-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.78e-37
Family Translational machinery components 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|347523604|ref|YP_004781174.1|
Sequence length 144
Comment 30S ribosomal protein S9P [Pyrolobus fumarii 1A]
Sequence
MSAQAAQQKPTVRIVIATGKRKTAIARAVIKPGKGRVWINGVPLELWPIEMARWKMMEPL
LLAGKDIWSKVDIKVNVRGGGIMAQADAVRMAIARGLVEFTGSQELREIFEEYDRSMIAG
DPRQTEPEKPMRRSARRRWQKSYR
Download sequence
Identical sequences G0EF25
gi|347523604|ref|YP_004781174.1| WP_014026599.1.63292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]