SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347523638|ref|YP_004781208.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|347523638|ref|YP_004781208.1|
Domain Number - Region: 55-95
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000243
Family FHA domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|347523638|ref|YP_004781208.1|
Sequence length 155
Comment hypothetical protein Pyrfu_1088 [Pyrolobus fumarii 1A]
Sequence
MIDPKGLLIVSTAIALVSVVIGMAFASSSIEVVKACIVERGAHHSILLELNVGGLHSLRG
VWVNGERIEMTSPIVITSGRVVLLIESMSSVRVFPSIDAAMRYIMSPDYSLFPGRPLPDA
IVYHVRLVFDSGLVIDYVIKKGDQVGDRVVVCRSS
Download sequence
Identical sequences G0EF59
WP_014026633.1.63292 gi|347523638|ref|YP_004781208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]