SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347523706|ref|YP_004781276.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347523706|ref|YP_004781276.1|
Domain Number 1 Region: 13-280
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-39
Family Protein kinases, catalytic subunit 0.0014
Further Details:      
 
Domain Number 2 Region: 301-360
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000000018
Family FHA domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347523706|ref|YP_004781276.1|
Sequence length 428
Comment serine/threonine protein kinase with FHA domain [Pyrolobus fumarii 1A]
Sequence
MTGCRLEQKPAEPIQGTASTYHVVKLLGSGGQVCAWLGVDRATGEYVVIRVPRPDLPPDL
YQLQVNRLRIAYRILYVLYQYASQTRLHMYFEQPHDYTDMDHTFMMMTKYVEGDDLESFI
ACSEMGMLSSECKRVVGGLLDAVYFMHQLGIIHRDIKPRNIRSAPWGPVLIDFTTAKYFY
DVTLGDVYVYSTGGYTAPEQMEYAIASPQSDVWSMGATLLRLAARKEPARILRGYPKQLR
RLAPHDIKRIAPRAEGLAELIAAALDPDPCLRPATLDEARTLIGGGSIEVGFAEVILLGN
KYTIEERGVCIGRSSSCHIQIPRDRDPNNFISGVHAVIFWDELRKEWMIQDMCSLNGTAV
WRPGIDEHWVIVWPGRKVTGHICIKGHPVGEPLPLGKSALISLGFDQNLGPYLIAVFRAG
PQIISSIA
Download sequence
Identical sequences G0EFK0
gi|347523706|ref|YP_004781276.1| WP_014026701.1.63292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]