SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347523776|ref|YP_004781346.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347523776|ref|YP_004781346.1|
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.87e-22
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347523776|ref|YP_004781346.1|
Sequence length 97
Comment DNA polymerase beta domain containing protein [Pyrolobus fumarii 1A]
Sequence
MLAEIVERVRAVLGEAQVYLFGSYARGDWLEDSDIDLIIVSPRFRGLDPGKRYAMIRELL
PGDVSLEILLYTPEEFERAKKRSVVVQDAMEYWMRLL
Download sequence
Identical sequences G0EFZ3
gi|347523776|ref|YP_004781346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]