SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347523835|ref|YP_004781405.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347523835|ref|YP_004781405.1|
Domain Number 1 Region: 304-464
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.48e-55
Family DNA gyrase/MutL, second domain 0.00000179
Further Details:      
 
Domain Number 2 Region: 21-225
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.55e-31
Family DNA gyrase/MutL, N-terminal domain 0.00000381
Further Details:      
 
Domain Number 3 Region: 229-300
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.0000000000353
Family Topoisomerase VI-B subunit middle domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|347523835|ref|YP_004781405.1|
Sequence length 526
Comment DNA topoisomerase VI subunit B [Pyrolobus fumarii 1A]
Sequence
MDHELKQITVAEFLYKEKQLWGFENPARALYQTIREYVENALDATDLYGILPNVTVIIEQ
DEKDKSICTVTVEDNGIGIPPQKIAEALGKPLVTSKFKIRQSRGQFGLGAKAVTVYALST
TGSPIEAYSSPLDSERVYYVKFSIDLSTNEPAIYALGSWRKSTKWHGTRIRARIRCNWSY
ARSRILKYFEMLAIVTPYADIVFIEPDGTIHHYPRIVEKMPRPPKEVKPHPASLEKGELQ
MLLKRTTARTIKEFLISTFQRVGEKSALNVLKLAGIDPSKPPQSLTDEEIERLHKALRSY
KFPAPSSEALAPIGAELIEAGLKAILKPEFVVAVTRKPRMHSGGHPFIVEVGIAYGGAIE
PREQPLLLRYANRIPLIYDEKADVAWKVLEEFNWKHYGVNFPAPLVVLTHICSTKIPWKV
GSKEAVAEREEIKEELHLALQEAARKLRHYLIEKRREEELREKISTFLRYIPEVAQSIAT
ILGEDGVTPDKVQRLLLDTLRRRMKGKELQVFEQQVKNLSKVKIEA
Download sequence
Identical sequences G0EGC8
WP_014026830.1.63292 gi|347523835|ref|YP_004781405.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]