SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347523848|ref|YP_004781418.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|347523848|ref|YP_004781418.1|
Domain Number - Region: 6-30
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000815
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347523848|ref|YP_004781418.1|
Sequence length 53
Comment zinc finger protein [Pyrolobus fumarii 1A]
Sequence
MAGGRPCPVCGRGMFRRKALLEHIKTSHGWYFKEFIEPKGKGRGGGKKKKERE
Download sequence
Identical sequences G0EGE1
gi|347523848|ref|YP_004781418.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]