SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347524046|ref|YP_004781616.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347524046|ref|YP_004781616.1|
Domain Number 1 Region: 167-441
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.04e-77
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000132
Further Details:      
 
Domain Number 2 Region: 7-115
Classification Level Classification E-value
Superfamily tRNA-binding arm 2.77e-22
Family Seryl-tRNA synthetase (SerRS) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347524046|ref|YP_004781616.1|
Sequence length 463
Comment seryl-tRNA synthetase [Pyrolobus fumarii 1A]
Sequence
MPLWSVLKLIRENPEAYKESLRKRGLDTSIADRVRELDELWRKKLQEVNEVRHKHNVVTR
MIAKARDPEERKRLIEEARRLLKLREELEKELKRIEEEREKLLWGLPNIVLPDVPVCPEG
VEGIPIRFWGKPKVWEGHIDQFKEQTERWGFRVEHEVIAQKPVGHADMLENVLKLGDTRK
AAEVAGSRFYYLFDDLVWLDIALLMYAIDFLTQRGYRLVLPPYMLRHRVIMGVIDIETFK
DAIYKIEDEDLYLIATSEHPLAALYMNEEIREDDLPIKLVGVSPCFRKEAGAGNRDLKGI
FRVHQFHKVEQFVFAKPEESSQILEELIRNAEELFKGLGIPYRVVAICAQELGAPAAKKY
DLEAWMPAQGRYREMVSASNCTDWQAYRLNIRLVRKNMEKEYVHTLNSTAIASTRTITAI
LENFQEPDGTIVIPKVLRKYLEPFPKAPKDAIHPVKRERGGKG
Download sequence
Identical sequences G0EHL1
WP_014027041.1.63292 gi|347524046|ref|YP_004781616.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]