SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347524055|ref|YP_004781625.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347524055|ref|YP_004781625.1|
Domain Number 1 Region: 87-247
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.71e-23
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.0048
Further Details:      
 
Domain Number 2 Region: 21-91
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.0000000000000095
Family Ferredoxin reductase FAD-binding domain-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347524055|ref|YP_004781625.1|
Sequence length 252
Comment dihydroorotate dehydrogenase electron transfer subunit [Pyrolobus fumarii 1A]
Sequence
MGTQFVSVRVMRVKRYGGLAWLRVSPLGFTADPGQFVMLWVPGLEAVPMSIAWMDSLGAE
FIVRSVGETTKHIHELKRGDAIGVMGPLGRGISSVMNVHVHKVLLVGGGSGVAPILYTAG
VLGARGYDVNIVLGFRSREEAGIREVFEHHGVDVTVVCEDGVGGPCDYEGLVTEPEFVKK
LVTSADVVISAGPLPMMKAVYRLAGDKLIAIMESIVKCGVGFCGSCRLWPGGPLLCRDGP
VFTASEIRRLLE
Download sequence
Identical sequences G0EHM0
WP_014027050.1.63292 gi|347524055|ref|YP_004781625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]