SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347524190|ref|YP_004781760.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347524190|ref|YP_004781760.1|
Domain Number 1 Region: 501-620
Classification Level Classification E-value
Superfamily vWA-like 0.000000000000496
Family RoRNP C-terminal domain-like 0.058
Further Details:      
 
Weak hits

Sequence:  gi|347524190|ref|YP_004781760.1|
Domain Number - Region: 377-441
Classification Level Classification E-value
Superfamily CorA soluble domain-like 0.0114
Family CorA soluble domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|347524190|ref|YP_004781760.1|
Sequence length 658
Comment VWA containing CoxE family protein [Pyrolobus fumarii 1A]
Sequence
MKEDLVSLCIRIAYRLRREGLQVGTSEIVDALRIAENLALLEGKELDKEILHDVIRAVFA
HNDREETVVERVWREINQSQNSIARVIAAVEDDLRRLGLGWGSRIYSKKKLLNGPHAEER
REAYSRLRLLGLIVRTPRGDVVLDRDAAIRRIRSLLRQYGSAWDALAASAARMISRGKLE
WFALYAAPVDEEKLDGIEIDRIALAALQALQEGNRGLARKLASIVAKRLESGETPRDSWS
AYKLLRNLDALTPRSLASLLRSEPRLALELLRSRESRDMLAEALRLLDANALRSILRKIS
HDRRGIGVAAGLLGEVDLSVWSEVRISRQPRSWEEAVVAIAGMLARAEQGFLAAARGDEA
QLDYALYELEKVKQIDYSEAPDWAIRAIERYRERVEQLRSVIEGVSDAMIRLYSIVKRMQ
PDEALLYLREVYRSGDDHLKRTALRLAEIVWRRMEARAAKHAKRSSETIISQRGRVDVRR
TVYNLVALRENPIVARKRRKKPSIALVLDTSGSMAKYTLWALLAASSFSGLVYTLTLFSS
DVEIVQNAWKLSRRRIIELLFRVSFEGYTNISVALRETARVYTTPSKMVIVTDLCQTVED
ERPSETAARLAREGWHLLFILPPRHCSNERRAVSEYATVRVVARPEDIPRFLSRLSGI
Download sequence
Identical sequences G0ECD8
WP_014027185.1.63292 gi|347524190|ref|YP_004781760.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]