SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347524217|ref|YP_004781787.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347524217|ref|YP_004781787.1|
Domain Number 1 Region: 131-211
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-23
Family Translational machinery components 0.0012
Further Details:      
 
Domain Number 2 Region: 47-118
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.26e-20
Family Ribosomal S5 protein, N-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347524217|ref|YP_004781787.1|
Sequence length 213
Comment 30S ribosomal protein S5 [Pyrolobus fumarii 1A]
Sequence
MAASQIDLEAEWKPRTYVGRMVKEGKIKSIYEIFEKNLPILEPEIVDWLVPDLKHETVDV
GIVQKMTDAGRVSRFRVVVVVGNEDGLVGVGQGKAKQLRVAIEKALRNAKLNIIPVRRGC
GSWECMCGEPHSVPFTVRGKSGSVVVVLKPAPKGTGLVAGEAAKVVLRMAGIRDVWTFTK
GETRTTINFVKATYNALKQTYQFVTPADWVNVQ
Download sequence
Identical sequences G0ECG5
WP_014027212.1.63292 gi|347524217|ref|YP_004781787.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]