SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347524274|ref|YP_004781844.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347524274|ref|YP_004781844.1|
Domain Number 1 Region: 8-172,261-349
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.86e-44
Family Bacterial dinuclear zinc exopeptidases 0.0035
Further Details:      
 
Domain Number 2 Region: 159-253
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000000000000419
Family Bacterial exopeptidase dimerisation domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347524274|ref|YP_004781844.1|
Sequence length 359
Comment N-acetyl-ornithine/N-acetyl-lysine deacetylase [Pyrolobus fumarii 1A]
Sequence
MEARLPSLERIVEHLRRLVEVYAPTGEEERLHPVLREIAEELGADYVIDEVGNFFIVSGD
GHPNIVLVSHLDTVPGELPVRVEGTTVWGRGAVDARAPLLAMVYAAALYKGPCTVWGGGV
VAEEGDSRGAWHLVRKGVKPDYIIIGEPSGTTGVVIGYRGSAPSRVVCRGRGGHGASPWD
ADSALEKLIDYYVSLRNRSGRSFNEITAVATIIRAGDYPNKLPEEAVAHLDVRVPPGKSI
EDVRAFLEEGLPRDCRVEVLGYTPGIRVRPNDPVPRALIRGLIREGAKPRILLKHGTSDM
NILAQVARSIAAYGPGDSRLAHSTEERVDAKEVLLATRVLIHAIRELCETLRRRQTRHS
Download sequence
Identical sequences G0ECM2
WP_014027269.1.63292 gi|347524274|ref|YP_004781844.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]