SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347524327|ref|YP_004781897.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347524327|ref|YP_004781897.1|
Domain Number 1 Region: 9-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-72
Family G proteins 0.00000339
Further Details:      
 
Domain Number 2 Region: 470-630
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.42e-54
Family Translational machinery components 0.0000158
Further Details:      
 
Domain Number 3 Region: 261-381
Classification Level Classification E-value
Superfamily Translation proteins 3.77e-29
Family Elongation factors 0.0011
Further Details:      
 
Domain Number 4 Region: 631-724
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.88e-24
Family EF-G/eEF-2 domains III and V 0.0039
Further Details:      
 
Domain Number 5 Region: 394-470
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.96e-21
Family EF-G/eEF-2 domains III and V 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347524327|ref|YP_004781897.1|
Sequence length 739
Comment translation elongation factor aEF-2 [Pyrolobus fumarii 1A]
Sequence
MPRVKFVHEILQIMRNPEQVRNIGIIAHVDHGKTTTTDSLLAAAGIISRKVAGEALAMDF
LSVEQQRGITVKAANISLYHEYQGKPYVINLVDTPGHVDFSGKVTRSLRMIDGAIVVVDA
VEGVMPQTETVLRQALEERVRPILFINKVDRLIKELKYTPQQIMQRFVEIIKEVNSLIEL
YGEAPYKDQWKIDPKKGNVAFGSARDKWGFTVPMAEKKGIKFSDVIEAYNKGKEAVEEFA
AKVAPLHEALLDMVVKFIPDPRTAQRYRIPKIWRGDMNSEIAKAMMEADPNAPVVFVVAD
MRLDPKIRRLVATGRIFAGTLRPGVEVWLVNAKKKQRILQVSIYMGPDREVVDEIPAGNI
AAALGLDEARAGETVVDLSLKDTMAPFERLRYVSEPVVTVAIEPKNPRDLPKLIEALKLL
SIEDPNLVVKINQETGEYLLSGMGPLHIEIALWSLKENFGLEVKTSPPIVVYRETIRAKS
QVFEGKSPNKHNKLYISVEPLDEKTIELIQKGVITDDMDPRERAKILRDEAGWDYDEAKR
IWAIDENINVFVDKTTGVQHLREVKDTLIQGFRLAMKEGPLAKEPVRGIKVILHDAIIHE
DPAHRGPAQLFPALRNAIYAGMLTARPTLLEPLQKLDIRVPHEYVSNVIAVITKRRGKII
NMIDMGMVMRIIAEVPVSESFDLAAELRSASAGRAFWGTEFSRWAPVPENLLMEIVKKIR
ERKGLPPEPPKPEDFIEQY
Download sequence
Identical sequences G0ECS5
gi|347524327|ref|YP_004781897.1| WP_014027322.1.63292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]