SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347524349|ref|YP_004781919.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347524349|ref|YP_004781919.1|
Domain Number 1 Region: 139-395
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.5e-76
Family Extended AAA-ATPase domain 0.000000588
Further Details:      
 
Weak hits

Sequence:  gi|347524349|ref|YP_004781919.1|
Domain Number - Region: 24-63
Classification Level Classification E-value
Superfamily Prefoldin 0.00523
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347524349|ref|YP_004781919.1|
Sequence length 406
Comment 26S proteasome subunit P45 family [Pyrolobus fumarii 1A]
Sequence
MASAFEDKPGVGEKAEVKVHLDCETLFEYVKMLERRLRELEAERESLRRELRYYKSEVQK
LMEAPLIEAIVLDTLPDGRVVVKSTTGPNLVVKVSNRVDISKLQPGMHVALNSRGSAIVD
VLPQREDPYVKGFEVVERPKVRFSDVGGLKEQIRELREAIELPLKNPELFKELGIEPPKG
VLLYGPPGCGKTLLAKALAGETNATFIHVVGSELVHKFIGEGARIVREVFQLARRKAPAI
IFIDEIDAIAAKRVDIGTSGEREVQRTLMQLLAEMDGFDPLDDVKVIAATNRIDILDPAI
LRPGRFDRLIYIPPPDEEGRYEILKIHTRRARLAPDVDLRYIAKITEGATGADIKAIVTE
AGYFALRAGRREITMEDFLKAVEKVLKHRKRPYAEKKHQEKPPFYT
Download sequence
Identical sequences G0ECU7
WP_014027344.1.63292 gi|347524349|ref|YP_004781919.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]