SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347524419|ref|YP_004781989.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347524419|ref|YP_004781989.1|
Domain Number 1 Region: 195-252
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0000000835
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.088
Further Details:      
 
Domain Number 2 Region: 53-151
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000041
Family GHMP Kinase, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347524419|ref|YP_004781989.1|
Sequence length 267
Comment shikimate kinase [Pyrolobus fumarii 1A]
Sequence
MRARAWLGATIVNAVASWKGAAVAISEHIEARLYKGSCDCGLPCMALRAVGGDGFCVEAS
ASLGFRGGVKSSSAVVNASLLAFLRYRGVHDPSPRFIVDVNARVGIEAGVSVTGAADDAY
ASLLGGVVVVDNRRRVVVKRYEPPRDTLVVLLKPRGVNRLWPPCRPELRGQAARVAERAW
EEALEGRVFEAVRLNWEAYRGYLCAPLEPVRLALEAGALAASLSGLGPVYEAFVEEDAVE
RVVAAWRALGEVTVVRLESRPVCCLTG
Download sequence
Identical sequences G0ED59
gi|347524419|ref|YP_004781989.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]