SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347524458|ref|YP_004782028.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347524458|ref|YP_004782028.1|
Domain Number 1 Region: 63-248
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 3.25e-30
Family NADH oxidase/flavin reductase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|347524458|ref|YP_004782028.1|
Sequence length 250
Comment SagB-type dehydrogenase domain containing protein [Pyrolobus fumarii 1A]
Sequence
MLARGLSVLCETRDPGLALQESTAIERWGYYGEPRPEFPGFFKRLACAARVRLPEPLGAS
GVDVLEAIRRRESRREYGDMPVSLEQLSTLLFYAAGVRGYELGWPLRTYPSAGGLQPVEV
YVNAWSVEGLEPGLYHYDAERHELCLLGEPIPRDRLASICLDQEHAGDGSLALIITAVYA
RTASKYGARGYRYIHLDAGAVVQNVYLVTEALGLATVVIGAFYDHELCNELGIDCRWELP
MAVMPVGTRP
Download sequence
Identical sequences G0ED98
gi|347524458|ref|YP_004782028.1| WP_014027453.1.63292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]