SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347523587|ref|YP_004781157.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347523587|ref|YP_004781157.1|
Domain Number 1 Region: 1-199,324-406
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.27e-57
Family Bacterial dinuclear zinc exopeptidases 0.0033
Further Details:      
 
Domain Number 2 Region: 202-315
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.36e-17
Family Bacterial exopeptidase dimerisation domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347523587|ref|YP_004781157.1|
Sequence length 410
Comment acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase [Pyrolobus fumarii 1A]
Sequence
MLDKLLSRIESLRGYAVELYKKLVPLKAIPPDFGGKGELRRAEALQEELERLGLHVERYD
ARDDRAEGGVRPNLVVKLGSGRPRLWIISHLDTVPEGDASLWKYPPYQATVVGDRVYGRG
VEDNLQAVVSSLLLLRALSEEQTEPPITLMVAFVSDEEAGSRYGVRYLLEKTGVFRSGDW
VLVPDYCSSDGSRIEVAEKHILWFKVVIEGRQVHASMPHEGLNAHRLGMMFNLELDKTLH
EKFSGFDEVFEPPVSTFEPTKKEANVANINTVPGRDVVYWDCRVLPRYDLDDVIETVKSM
AYWFALRSNAKIDVEVVMKDAAGEPTSPSHPLVRYLSESIREDRGIEPRPVGIGGGTVAR
YFRKRGMPAVVWQTCDATAHQPNEYAKIDNAVADARVFARLIFKLGGQSG
Download sequence
Identical sequences G0EF08
WP_014026582.1.63292 gi|347523587|ref|YP_004781157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]