SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347524281|ref|YP_004781851.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347524281|ref|YP_004781851.1|
Domain Number 1 Region: 20-185
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-48
Family Ribonuclease PH domain 1-like 0.00000224
Further Details:      
 
Domain Number 2 Region: 159-244
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.4e-24
Family Ribonuclease PH domain 2-like 0.0000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347524281|ref|YP_004781851.1|
Sequence length 248
Comment exosome complex exonuclease 1 [Pyrolobus fumarii 1A]
Sequence
MAKREPPVPLITKTEEGRIVRHDGRAPDELRPIRMEVGVLSNADGSAYVEFGRTRVIAAV
YGPREVHPKHMALPDRALIRCRYHMAPFSTDERKSPAPTRREIELSKVIREALEPVVFTE
LYPRTTIDIFIEVIEADGGTRTAAVTAASLALADAGVQMRDLVAGVAVGKVQGVLVLDID
QLEDEYGEADMPVAMAPSLGWVTLLQLNGVLSREEFKEAMALARKGIEAIYKMQREALRR
KYAEVKTV
Download sequence
Identical sequences G0ECM9
gi|347524281|ref|YP_004781851.1| WP_014027276.1.63292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]