SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384260289|ref|YP_005404223.1| from Rahnella aquatilis HX2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384260289|ref|YP_005404223.1|
Domain Number 1 Region: 3-192
Classification Level Classification E-value
Superfamily HAD-like 1.17e-43
Family YihX-like 0.000000761
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384260289|ref|YP_005404223.1|
Sequence length 195
Comment alpha-D-glucose-1-phosphatase [Rahnella aquatilis HX2]
Sequence
MLYIFDMGNVIIDIDFKRVLGVWSHLSGTPLATLTERFSMGEVFQKHERGEISDEQFAAD
LCHEMGIALSFEQFSAGWHAVFVGLRPEVIALFQKLREEGHRVVVLSNTNRLHLDFWPHH
YPEIEANTDAMYLSQNLGMRKPEPEIFRHVLEKEGFTADQAVFFDDVAENIEAARNAGIE
AVWVEDNQTVPKYFS
Download sequence
Identical sequences A0A0H3FF63 H8NUM9
WP_013577650.1.59798 WP_013577650.1.91760 gi|384260289|ref|YP_005404223.1| gi|322835067|ref|YP_004215094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]