SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55376283|ref|YP_134136.1| from Haloarcula marismortui ATCC 43049

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55376283|ref|YP_134136.1|
Domain Number 1 Region: 6-80
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000000759
Family Transglutaminase, two C-terminal domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|55376283|ref|YP_134136.1|
Sequence length 355
Comment hypothetical protein pNG5004 [Haloarcula marismortui ATCC 43049]
Sequence
MDLTANDSVAGVESTGEVTVANGLDSQITNVEIVVEGDDIEMTQSRTVASSISQNGSMTA
PFRFRPESSGEHKLTTTVSYTVGDDITRTTTQTKVIDSDPLRNSVELDTTAVGSGTDRAL
RVAVSNGANAPLSDVTVNATSANASFQRVLLENISTSTTQEVRLNATTDEPRADVTVTAE
YELGTETERTTAETTLRSVPGTIDLTGLDVIRQGGRLQISGSASNVGSTDADSVLVSVAD
TENVTPATPNRDYFVGTVPASDFVSFDVYARTEGNVTSVPLEVTYLVDDTRKRQTFDVNL
DRMGGSAQQSEQDSDNGGGDQNSMLPVFIAGGLALLVVVGVLVRRYRSGDDEIEV
Download sequence
Identical sequences Q5V7G7
272569.pNG5004 gi|55376283|ref|YP_134136.1| gi|55376283|ref|YP_134136.1|NC_006393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]