SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55376417|ref|YP_134269.1| from Haloarcula marismortui ATCC 43049

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55376417|ref|YP_134269.1|
Domain Number 1 Region: 1-47
Classification Level Classification E-value
Superfamily PIN domain-like 0.000000673
Family PIN domain 0.014
Further Details:      
 
Domain Number 2 Region: 90-194
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000377
Family Regulator of G-protein signaling, RGS 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|55376417|ref|YP_134269.1|
Sequence length 265
Comment hypothetical protein pNG6005 [Haloarcula marismortui ATCC 43049]
Sequence
MTRYFVDTNVLIGLTFSHDRWAVEAERILDGHNTLFTSEFVIYEYCSRPQGAPRVVSDPD
QLQVDPDDTDGVFGTVLEDFQENVEDNIPMYNREIDLQRYDGLSFERILEIFFDNIEVRS
QAKPHFVRHFQDYFSSREITPRNAKRCVEDLRDRVLHDAKERKDALMDAVHVMSSTYDDQ
ERARGLVKEHIGIRESRIPPVDSQWLLDAIGLAERDVLQRIVTGDKKDIVRYQQQLTSLF
DVSILYILDEFHTRSQVGQDSHEIL
Download sequence
Identical sequences Q5V6X8
gi|55376417|ref|YP_134269.1| gi|55376417|ref|YP_134269.1|NC_006394 272569.pNG6005 WP_011222395.1.69175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]