SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55376482|ref|YP_134334.1| from Haloarcula marismortui ATCC 43049

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55376482|ref|YP_134334.1|
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.18e-17
Family Sfri0576-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|55376482|ref|YP_134334.1|
Sequence length 135
Comment hypothetical protein pNG6078 [Haloarcula marismortui ATCC 43049]
Sequence
MSHTAPDQMFEVLDETNENLIAIRVGKGTRTGYQELYSLLVEKSDKHGYIHVYEEVPNWT
FRAFLTHLHGVVPDLRYGPEFDIDRYAAVGDTRWAKLLFDWWYAIRPIWPVAPNEMRYFD
IKKRERALDWLREEI
Download sequence
Identical sequences Q5V739
272569.pNG6078 gi|55376482|ref|YP_134334.1|NC_006394 gi|55376482|ref|YP_134334.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]