SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55377002|ref|YP_134852.1| from Haloarcula marismortui ATCC 43049

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55377002|ref|YP_134852.1|
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.31e-33
Family Translational machinery components 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|55377002|ref|YP_134852.1|
Sequence length 132
Comment 30S ribosomal protein S9 [Haloarcula marismortui ATCC 43049]
Sequence
MVTNTSGKKKTAVARATVREGEGRVRIDSQPVELVDPELAQLKMLEPFRIAEDDLRGEVD
VEVSVEGGGVMGQADAARTAIARGLVDHTNDAELRDAFMEFDRSLLVNDVRQSEPKKWGG
PGARARYQKSYR
Download sequence
Identical sequences A0A0B5GXR8 A0A0N0BPR0 A0A165M8F6 A0A1H2VSZ3 A0A2H4ZW73 G0HVU5 M0JJ89 M0JYF0 M0KJR8 M0KLN0 M0KU31 M0L8K5 P05763 V5TJH6
WP_004516798.1.13069 WP_004516798.1.17807 WP_004516798.1.18001 WP_004516798.1.27393 WP_004516798.1.28678 WP_004516798.1.67629 WP_004516798.1.69175 WP_004516798.1.78115 WP_004516798.1.82819 WP_004516798.1.84793 WP_004516798.1.89716 WP_004516798.1.91835 WP_004516798.1.92404 WP_004516798.1.92869 WP_004516798.1.94779 gi|55377002|ref|YP_134852.1| gi|344211113|ref|YP_004795433.1| gi|564289117|ref|YP_008875347.1| 272569.rrnAC0066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]