SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55377163|ref|YP_135013.1| from Haloarcula marismortui ATCC 43049

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55377163|ref|YP_135013.1|
Domain Number 1 Region: 148-221
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000000994
Family Transglutaminase, two C-terminal domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|55377163|ref|YP_135013.1|
Sequence length 497
Comment hypothetical protein rrnAC0250 [Haloarcula marismortui ATCC 43049]
Sequence
MRHGVAVLACLVIVGSLPLSVAGASVNASISTVDVSPSSPAPGETVTFDTTVRNLESSDA
PLEINDIAIRKSGGRGITEYERVSDLGSISPGSTLEVPLTASFDSAGSKDLRVIVYGRDR
KTGDNIELKYPVQLNVQERHPQMDITADDSVAGVESTGEVTVANGLDTQITNVEIVVEGD
GVKVTNSLTVRSSVAENGSITAPFRFRPESAGEHSLTATISYTVDGDTTRSTTRTTVIDS
DPLRNSVELDTTAVGSGTDRALRVAVSNGANAPLSDVMISATSENASFQRVLLENISAST
TRQVRLNATMDEPRADVTVTANYELGTETEQMTTETTLRSVPGTIDLTGLDVIRQGGRLQ
ISGSASNVGSTDADSVLVSVVNTESVTPATPNRDYFVGTVPASDFVSFDVYAQTTGNVTS
VPLEVTYLVDDTRKRQTFDVDIDRMGASAQQAGQDDDSGGGDQNSMLPVFIAGGLALLVV
VGVLVRRYRRGDDDIEV
Download sequence
Identical sequences Q5V595
272569.rrnAC0250 WP_011222917.1.69175 gi|55377163|ref|YP_135013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]