SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55377611|ref|YP_135461.1| from Haloarcula marismortui ATCC 43049

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55377611|ref|YP_135461.1|
Domain Number 1 Region: 838-889
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000961
Family Type I dockerin domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|55377611|ref|YP_135461.1|
Sequence length 892
Comment cell surface protein [Haloarcula marismortui ATCC 43049]
Sequence
MVDFTRRQVLSQSVAAALGASVIGVASGEEVEETDTPGAPSVAGSLKRFSTTAFGAEVTG
PFVFEDGSLLYSLQHPEGENPEPFGRAAVGYFSGFQFEFDGSNDDFSEVGIPDTEEKQRQ
VRSAAGDYEVLIQGREEIQGGEERLGVPQTPDGVDLTALNGSSGGYGQNPDCNQFVATDD
EGTEGYLFTNWENYPGCISRVPISQDESGEWSADVGSDMTLNVVNTEPFRDIGGTWVNCY
GDLSPWETMISAEENYSHPRVSYTHTVGDIVESGTGVGKIGGCQFWNRPNPSEIGEALGD
YVEAGDIEEEFTIQGYWSQAGVEKAAYYLGADTVDQTEDGNDMTLIDDVYPNPYRYGYFV
DIREPAAETPSPMKYYVMGRAAWEAPDIQGDQRTVYGCSDGDSKGIYKFVADEPIPEYDN
TDDIAGTLYAPKITNDAANAAEAGQRNSPAQTPLEIEWMELGHATNGEAAEWIAEYDDVT
QADYITEHTEYSVDEIGTDVSVSDAVREADLTVLQSASGNQSYITNEDIVEWAEQYEANG
PDGVDEELRRIPFLETRAAAKEIGATIEFNKAEGVDTVDNSQPGDFIYFGISEFNDDLAN
DTGDIQMDRVDGGVVYRGVLESDYNVSTLEPVITGPDFTDEPEDANDALRNIDNVYTMRD
GRVLCCEDGFGGPARSYPNDGLYVYQPTVTVSANSAAVGSGSTGTVSLTASSLPAGFSGA
RLTVNVSNPEIASITGVSFPDALGLTESSVSDDGSSATIRVADVNTNVQSGARDVSLATL
DVRANGGGTTDLTVSIEQMDDENGNAIEAEARNGIVVGGPQTVVGDAAPTDPDGDGHFED
LNGNGRLDYEDVQVLFSNMDSDSVQLNTGAYDFNENGKLDFADVTALYEEVN
Download sequence
Identical sequences Q5V3Z7
272569.rrnAC0766 WP_011223219.1.69175 gi|55377611|ref|YP_135461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]