SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55379051|ref|YP_136901.1| from Haloarcula marismortui ATCC 43049

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55379051|ref|YP_136901.1|
Domain Number 1 Region: 49-314
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.4e-24
Family GpdQ-like 0.047
Further Details:      
 
Domain Number 2 Region: 556-605
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000726
Family Type I dockerin domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|55379051|ref|YP_136901.1|
Sequence length 615
Comment serine/threonine phosphatase [Haloarcula marismortui ATCC 43049]
Sequence
MDSSDRFERSATTTRRRVLKAAGAGVGLTALGTTASTGQQPDYWTVVALPDTQVYAKERT
PYAKDQTQWIADNTAAENIAFVSHEGDVVDHGDDDAEWQYIDEAMSTLDGVVPYATVTGN
HDYATLWDRNSSVAKYREYFGPSRYEGRDWFGGAGPSNGDEGRDNLNTYQLFSAGGYDFL
HLALEWEPPGTVDDPSTPLGWGQSVLDQYPDRAAILTTHSYLRDKPQRRTRKLQEASEIG
NTGQTVWEDLVSPNDQIFMVLCGHWHEGTGESGGEAHQVSTNDAGASVYELLANYQFRPN
GGNGFMRRIEFRPGDGADAPDRIQVRTYSPSTGAEKTDSDSQFGFDLDFDARFGSSSKTP
EPTETPKTPDGPTATFQQGTDGYSGTTDTMIRAADPETSYSTAETLSIDGSDPEGSGSSA
QALLRFGSITGTESGQIPPGSDVKQATVTLETSDAGDGAAVHRLRTDWSADSTWASLDGG
VQADGSQAVADAVARTGAVETGEISIDVTASVDAWVNGAQNAGWVFRPLGNDGWDIQSAD
NAIPPTLTVSYTPGETVAGDADGDGDVDTDDVDRIQRSVAGEDSDIDRDAADIDGDGDVD
IGDAVSARNLAGDDQ
Download sequence
Identical sequences Q5UZV8
gi|55379051|ref|YP_136901.1| 272569.rrnAC2380 WP_011224190.1.69175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]