SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55380211|ref|YP_138060.1| from Haloarcula marismortui ATCC 43049

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55380211|ref|YP_138060.1|
Domain Number 1 Region: 498-663
Classification Level Classification E-value
Superfamily vWA-like 1.26e-34
Family Integrin A (or I) domain 0.0031
Further Details:      
 
Domain Number 2 Region: 124-175
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000239
Family Type I dockerin domain 0.0036
Further Details:      
 
Domain Number 3 Region: 237-360
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000392
Family TSP type-3 repeat 0.0028
Further Details:      
 
Weak hits

Sequence:  gi|55380211|ref|YP_138060.1|
Domain Number - Region: 662-753
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000288
Family TSP type-3 repeat 0.01
Further Details:      
 
Domain Number - Region: 732-832
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000667
Family TSP type-3 repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|55380211|ref|YP_138060.1|
Sequence length 1562
Comment calcium-binding protein-like [Haloarcula marismortui ATCC 43049]
Sequence
MASSTTKLQALFGVLLLVAVGPVSGVMTGTGTGPLQTAGNDISGTSTGNQAVTTAGNEPT
QTQPTQTPAATAGNQATGPLSTSWNGSTEPNASAIAELAPRENDSHPYPLVGDNQPTDPD
GDGLYEDVNGDGAVNIVDVDALSRHLESTAAGANWSAYDYTGDNRTDVGDIQWLFVATRS
TPSNDTDGDGLPDAYERNVTKTDPRVADSDGDAVIDGAEDWDNDTLPAYREYRLGTDPQS
NDTDGDGLTDDVESRLQSVDPTDPDTDDDGVQDSAADPDNDSLSIYNETVAGTLSNDPDT
DGDGLLDGTEVHQLGTDPLKADTDNDGLPDGEEVRLGTDPLVADSNDNGVSDGEESYTTT
ATNETLGVTLSLTGNGDIGNGTTIAPQDDPRFNTSRVGNMSASPVVELNSEQEFSSANVT
LGYNETGVENESQDLAVFTYDPEAGIFVPLNSTVDATNNTATAETTHFSTFAVFDISNWA
TTYNATEPVRQTDDDGLRPVDVTLVMDTSGSMSSSVKLRNTAGQRFVAGLLDVDRAAVVD
FDSSAYVAQDLTSDFGAANSTLDNLGSGGGTDIGSGLSTANSQFASNSNDSRAQVMILLT
DGRGNGGISEAQTAANQNTTVYTVGFDNANRDKLRDIANITDGEFNYVTDRSELPNVFSR
IAENTTEINDTDGDGLSDEMEREGVILGGPNGDRVTTDPKSADTDGDGLSDSREIGQYTE
VSYSGRTASYYNHLANPRQVDTDGDNLTDAEEVAGWEVQRTTSADQSTEFTNTLYSSAGD
GMGHLETISVQSDPTLSDSDSDGVTDAQERRYRLDPHSHDTDNDSISDHREIVKGLDPTI
HDFQPPEVTVFTAQFSKPNSWADNRATYSLTFQVDDPSAVQTIVVSHDGETKATPRVREN
QYTHLIEYRTGYVQSLEDDLSAATTKIRVTDTHGNARSSPAFTRSTIFVEGAQHSEAVDT
NSRVAAQGLGFSSGLATTFGSSIESLQSFAKDPLRAIEAISTLLDSIPGLDSLSNLLSQA
PAVFDAMVQSYEDRQDRANPYDQDAKPELHKDFRANYFAGMLWGEVARSVTGSQAASAAK
RTQTANTVADRLGGTRVMRAARTYSRAQDRAGEWRARQQMRAISQLSKATTVPRSGARRV
LKPARTATDTVRIRHTIRRTDVDMAELDPAQQRRLGTLLAENDPAVARAVRQMDQDEIDA
LTRVEMDTRTRSDFARAYESGEVDSDELTTALTRYDSLDADGKAEFDDLLARNGDDAVDF
AGRTDSDTFDSTFRCDISSAPSLGAAGSLRSGRYHSVTAPSSPSLQSGGDCLPDKLGLSA
SEKSKYLSALNAGSDVDSGPITTADELEGLLDDLQGREGFDDIGKIAGDIQGNKKGFKGL
AGEGHVGRALDDRSNIDAGDGDIELEKDLSSDDIADEYSQDIADGVENSDAFKNVNSERG
GSSSDIDAKANTEVEINGRTLKDPAIESKNLDPDSAEFFRRDNWNGLKEKLRTHAVAGED
EIVVAMDQDYIDVEANRLGGSSSSSSREVLSNRLENDIETTLADEFGISKDVTVEVTSYS
DL
Download sequence
Identical sequences Q5UWJ9
272569.rrnB0167 gi|55380211|ref|YP_138060.1| WP_011224975.1.69175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]