SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55377185|ref|YP_135035.1| from Haloarcula marismortui ATCC 43049

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55377185|ref|YP_135035.1|
Domain Number 1 Region: 161-507
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.43e-33
Family Purple acid phosphatase-like 0.061
Further Details:      
 
Domain Number 2 Region: 687-738
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000141
Family Type I dockerin domain 0.0063
Further Details:      
 
Weak hits

Sequence:  gi|55377185|ref|YP_135035.1|
Domain Number - Region: 85-153
Classification Level Classification E-value
Superfamily Purple acid phosphatase, N-terminal domain 0.00109
Family Purple acid phosphatase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|55377185|ref|YP_135035.1|
Sequence length 741
Comment alkaline phosphatase [Haloarcula marismortui ATCC 43049]
Sequence
MRPTDLPEIDTTAQNRRTFMQRTGGVSLAAVLGLSKGASAMVDDDGNFESDPYTLGIASG
DPLPDSVIIWTRLAPNPLEADGAMPSETFSVEWTVATDEGMSDIVNTGTATAEPDHAHTI
HVDADGLEPATEYYYQFACRGETSPIGRTKTAPAAGASVDAFQFGFASCNRWVDGHYTAF
GQMAEDELDLIVHLGDYIYEYGIDVSESPREKSLPQEYKKETTDLDTYRLRYGLYKSDPN
LRAAHASAPWLVTRDDHEVDNNWAGNVPQDPDKQSTEAFIQRRAAALKAYYEHLPFRMEQ
KPDDASQKLYRYYEFGDLLDFNVLDTRLYRSDQACDDVFNKVDCAERFEEDRTILGDAQE
EWLLENLSATETTWNVLANQLPFATMDFKQGPEEGFRTEQWDGYVPEQNLVKTAFEEDAN
NPVVITGDFHSHWANTLISAKDGSSEPVGAEFVGTSISSGGNGTDMDDFGRYVVTENDNV
EYYNNQRGYVRCTVTPDNWTTEFQVLEYVDEPGAPMRTDATVELTAGQPGIPDDNPLILA
DSIAVGNGKNGTAELTGRWLETGLSGAAMTVTISDPEIATITGVSVADPFSISETDVASD
GASADIRFADVEKNAQSVVGGTDTRLATLDIRGQSAGTADIEVSVERLDDDSGTALVANT
ELGVIIVGPPPVTGSDEPTDPDGDGHFEDVNGNGRVDYDDIQLLFDNFDDDSVALNKTAY
DFNENGKLEYDDIVTLYSEVN
Download sequence
Identical sequences Q5V573
272569.rrnAC0273 gi|55377185|ref|YP_135035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]