SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|20680|e_gw1.11.4.1 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|20680|e_gw1.11.4.1
Domain Number 1 Region: 726-862,1035-1181
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.07e-34
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0085
Further Details:      
 
Domain Number 2 Region: 55-137,354-533
Classification Level Classification E-value
Superfamily Sialidases 6.08e-28
Family Sialidases (neuraminidases) 0.019
Further Details:      
 
Weak hits

Sequence:  jgi|Phybl1|20680|e_gw1.11.4.1
Domain Number - Region: 816-894
Classification Level Classification E-value
Superfamily Sialidases 0.0108
Family Sialidases (neuraminidases) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|20680|e_gw1.11.4.1
Sequence length 1295
Sequence
MSSTLLWFQALLVFISLASVMAQNIKVEKTGFDRVPDKLFYFQGSQVALWFDAGARVLWR
SSDQGKAWTRVTDIAENEPSFLYEHPFDNEKAYVIGKGKVHWKTVDRGASWQKFETPIEP
AATFPHLSFHAERPNYVLFNGFKCNLGGWTGMDCHGEFYYTLNNFEETALLRSQATYCIW
SLSSAAFETAPVKEVMCVEPAKKSGMASMLEYEELHLVQSEDFFKNEQAVNFGSTSEVRG
VIAISAVNRFLVAAIKPKPSEPDMDLQISLDGENWHEAIFPVDAKLVHEKAYTIVESTGT
SLLVDVLDSASSTVGTLYKSNSNGTFFVKSLENTNRNQLGIVDFERVQGVEGVMVANVVS
NAAQVKAGSAKKALQTRMSFDDGATWSPIQKVYDAQGTLLKCSDGPDKCALHLHSVTTPR
NNGQVFTSKAAVGVMMGVGSYNDHLLEYDESDTFLSTDGGLNWKLVRMGAHKYEFGDMGA
LLVLVDDEKEIDHIWWSKNRGNTWERYDLGISIRARYLTTDPTSSSSKFLLIGSSRFSNE
RVQSFYIDLSGVFSHKCELIENNESKSDFERWFARDLTSGPDCLMGHEQMFYRRKADRDC
YVGLDFQPPVVELKECPCTEADYECDYNFVRDGDKCVRIGPDVITKDMCTSRNSVYPSSS
GYRLIPGNTCNAEKGKKLDEPVDRRCGDNEDASYAQPPRPTQPMFDDEIDQFVYFKESPA
MLLRLRNGELWSSGEHGIGWKHVLQDKGVIRSFIMHEFDFNRAYALTDETIYVTSNQGAQ
WEEIKVPLAPTKHIALALDFHPLEKDWLLFIGDSTTVSSQSEMSSDCHSQAFYSQDQGRS
WRPIATYVRSCLWGRGGTMENTDENSIFCEEYQEKKGNQRSFISNRLSFTSSNNYYSSSE
TLFDAIVGVAVFGKFMVIAAVSTFLFLPPSIFLHISMDGKTFAQAAFPASLNLSPEAFTI
MESANSMWIHVSTNTHHGSEYGTIFTSNSNGTYFVASLENANRNEIGIVDFEKMQGIEGI
ALANRVSNPNQANMGDPKKLVTMKTADAGAHWFPLTAPQKDSKGKNYDNCKRGVDCNLHL
HSYSERRNTRDLFSLSSAVGLMVGVGNVGPSLSTYRSGDMFLTRDAGKTWNEVYKGAHLW
EFADQGALLILVDDEDPTNVVKYTTNEGISWQEYAFTTPEKRLKVEDIITQPDGTSQKYV
IFGTEYGSSNVVAYHIDFSALHPTKCKLDLSHPSDDDFELWSPEDTRGEACLFGRETKYY
RRIQDRDCYIGEKLVQPREEVRNCACQQEDYEWQV
Download sequence
Identical sequences A0A167MJ73
XP_018291026.1.77709 jgi|Phybl1|20680|e_gw1.11.4.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]