SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|57988|fgeneshPB_pm.48__2 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|57988|fgeneshPB_pm.48__2
Domain Number 1 Region: 20-207
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.34e-35
Family RNA methyltransferase FtsJ 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|57988|fgeneshPB_pm.48__2
Sequence length 293
Sequence
MGKSSKDKRDVYYRLAKEQGWRARSAFKLLQLDEEFNLLQGVHRAVDLCAAPGSWSQVLT
QRLSQNHAQNPQEQEPKIVAVDLQAMAPLDNVIQLQGDITKESTAEKIISYFEGELADIV
VCDGAPDVTGLHDMDEYIQAQLLLAALNITTHVLRPGGCFVAKIFRGKDITLLYSQLKVF
FPTVTCSKPRSSRNSSIEAFIVCQNYTPPPNYTPTMTNPLLDLHYDAANALVGPNRTIVP
FLACGDLNGYDADRTYPLQTSYTSLDPLQPPITAPYKTAMELKRNNFYNKVAK
Download sequence
Identical sequences A0A167N7Q7
jgi|Phybl1|57988|fgeneshPB_pm.48__2 XP_018293290.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]