SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|79103|estExt_fgeneshPB_pg.C_220117 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|79103|estExt_fgeneshPB_pg.C_220117
Domain Number 1 Region: 8-150
Classification Level Classification E-value
Superfamily Ribosomal protein L13 9.81e-50
Family Ribosomal protein L13 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|79103|estExt_fgeneshPB_pg.C_220117
Sequence length 202
Sequence
MSTFEKVVVIDGKGHLLGRLASIVAKQALNGQKVVIVRCEELNVSGEFFRNKLKYHAYLN
KRCVVNPRRGPFHFRAPSRILYKAMRGMVPHKTARGAAALDRIKVFEGVPPPYDRMKRMV
IPDALRVLRLKPGRKFTTLGRISHEVGWKYQDVVAKLEDKRKAKSSAYYERKAALIAIQK
KAVESKAASLKTVNASIAALGY
Download sequence
Identical sequences A0A162V8J6
jgi|Phybl1|29374|estExt_Genewise1.C_40466 jgi|Phybl1|79103|estExt_fgeneshPB_pg.C_220117 XP_018285950.1.77709 XP_018298842.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]