SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|19328|e_gw1.7.276.1 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|19328|e_gw1.7.276.1
Domain Number 1 Region: 8-172,219-260
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.21e-44
Family Phospholipase D 0.062
Further Details:      
 
Domain Number 2 Region: 276-420,499-553
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.98e-28
Family Nuclease 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|19328|e_gw1.7.276.1
Sequence length 724
Sequence
MESIDKVQSESPWVKTHRFGSFAPIRSNAKVKWFVDGENHFNAVAEAILSAKSEIYIADW
WFSPELYLRRPPEKNEEFRIDRLLKRKASEGVMIYVVVYKEMSVALTINSAHTKQWLQGL
HPNIIVQRHPDHKIVGEDVFFWSHHEKIIVVDNRLAFIGGLDLCFGRYDTHSHRLADHPA
VGHEHKIFPGQDYSNPRSKDFVNVIQYDQTLVDRESIPRMPWHDATIGVVGPIARDISRH
FIQRWNFLKTNKSSHRSAVPFLMPKGEYVAARDESNFTGTCRVQLLRSSSSWSSGIEREH
SIYNAYMECISESKHFIYFENQFFITVTYSDKLLKNMIGQALVDRIKRAHAKKEKFKVFV
IMPLVPAFEGDLASAESASARTVMHFQYTSISRGGNSIIEKLREAGIEPSDYIGWYSLRN
WDKLEPPFSAAPPKPKPKQNPKPSTSSKIKKSVDDDTKSPFDDQASLDCDSGIADDPFSD
KNNVDSDDSDEYEIDDRDHYVSELLYIHDKLMIVDDVTVLIGSANINDRSLLGNRDSEIA
MLIEDTEVVISHMDGKEYRATKFAHTLRMQLWKEHLGLLEFDDWGSLLPKATVNRSPDTL
SPESQSHVRFRSHSISPALDPLADHCYYDIWRRTADVNTKIYRDLFRCVPDDTVHTFEQH
RQFIPDSSIPQGHVADPSRSGREIRQELNNVRGHLVMFPTDYLKDENMMGSSLLETVTPL
VIFT
Download sequence
Identical sequences jgi|Phybl1|19328|e_gw1.7.276.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]