SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|28063|estExt_Genewise1.C_20328 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|28063|estExt_Genewise1.C_20328
Domain Number 1 Region: 191-500
Classification Level Classification E-value
Superfamily Mitochondrial carrier 3.53e-71
Family Mitochondrial carrier 0.0000912
Further Details:      
 
Domain Number 2 Region: 17-172
Classification Level Classification E-value
Superfamily EF-hand 1.37e-28
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|28063|estExt_Genewise1.C_20328
Sequence length 508
Sequence
MNQHSDQPRHPYYDEKVAERENRVKNLFDSLDTNNTGYLDADAIIRGFLKLTHLPTHTSY
ATDLLAKCNTSRDGLIDYEEFRAYVLEKERELWALFSEINKSNDHRLRAGDLKSALKAAG
VCVTEDDIEQFIQAIDTEGNGYIDFQDWRDFLLLLPQDTTIIEIYKYYQTSTQLTPDAEV
VFPHTDEAVGNAYKYLAAGGIAGAVSRTCTAPLDRLKVYLITQTSYQAQAKAPMSITAAL
KHIYSQGGLRAFFVGNGLNVVKIVPESAIKFYVFETAKSIMAELTNSEDKNGIPVSARFI
AGGMAGLCSQFCIYPVETLKTRIMANHGGSPVAIPNPHMPCTSGKPQSYIFLTAKEMYKT
KGIRAFWPGLTLGLLGVFPYQALDMGIYETLKVTYLQHMNKQAAEHRQTGEAPQPNVLVL
WTCGMVSGSIGATSVYPLNMIRTRLQAQGTAGHPHRYNSAFDAVKKTFQADGIKGFYKGL
GPTLFKVVPSVSISYAVYEFSKRSLGIS
Download sequence
Identical sequences A0A167NKR5
XP_018294198.1.77709 jgi|Phybl1|28063|estExt_Genewise1.C_20328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]