SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|67978|fgeneshPB_pg.21__30 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|67978|fgeneshPB_pg.21__30
Domain Number 1 Region: 501-554
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0054
Further Details:      
 
Domain Number 2 Region: 184-268
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000351
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 
Weak hits

Sequence:  jgi|Phybl1|67978|fgeneshPB_pg.21__30
Domain Number - Region: 430-492
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000994
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 
Domain Number - Region: 587-657
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|67978|fgeneshPB_pg.21__30
Sequence length 911
Sequence
MYIVLSPSLFYAAFEQRMGSFRQWDWINLRIMPNIAYATCIAAPYGKGHTVSLARLAHLQ
SEFTNQHTQLEVIHFQPSKLSLSKSKPQAIQATLAGSISPTMKARGAFLRQNPIQVKLSV
KSFSSSILRNHASLTELLVGLQKISDENKPTKVVCTGTEITIFGTIDSAEAIRVKVLVFL
DVMSRLISDTLEIPHHLHNLMAGRKHSHLQPIMEETATNIYLQSPFTSQIHSNTSSHLSD
TSGLINITGESTVSIQRAKELLTRLAAQKVKSLFKKESTMSSSKIDWILLRQREEIRNIM
RDNGINSNTRSFIRFPLLGSGDNKIVVYAENRVNVERTYRLLNYLIFSIYRAVFSFSPEE
ESESVIRSPDTIMKQVFGSYEKMLQTVGCLAETSSSEVIYNLEDCQFEILGTEREVRNAY
QFLCGIPTFKRHHKHTIFSLELASDHQDFISGKKNGKINKIMKSCAVQVKFHTVGQYTFM
VSIDSNSPNKAIDGLSMLQEELPAEISFYVPEMYHRRIIGVGGKNIQRMMKTYGVYVKFS
GSEEFSSLGGYFENEDNVVARTPMKNAPNLENLRRAVMEYVGLEKDRDFIPQRLLLPIYL
HRTILHKYGKTLRDAARPSNTKIWWPERQGSGEVTVFGPVTETNEILRMLKRHIPEEKTS
LGPVKMVKEEPEIDATIDFKNGLQKTQSVPKAGLFEYSRLYRPTLDLPRNEPVTNQPLES
PLSESPLYALYKGDIRSIFPSPDISQSLSKVMSTMPPTLGTRPLATLSAPIPSGNNIWIP
PKADYCSMFGISTESLHGPSYHDSMSEYIQEERFPIFSPLEDIQKNTTMFNEQRPMSNSF
IVRPRQHSVADDASLGWGPFNYQHSWPNIDFSRECFDGMVSYRQPPTTQDAFEMAPNIPR
RASLSTRTPSI
Download sequence
Identical sequences jgi|Phybl1|67978|fgeneshPB_pg.21__30

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]