SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|80145|estExt_fgeneshPB_pg.C_440067 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|80145|estExt_fgeneshPB_pg.C_440067
Domain Number 1 Region: 21-125
Classification Level Classification E-value
Superfamily PH domain-like 1.39e-25
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0021
Further Details:      
 
Domain Number 2 Region: 156-259
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000301
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|80145|estExt_fgeneshPB_pg.C_440067
Sequence length 669
Sequence
MPSIALSTAEDKNKIRRALPTSKIYAATVARVYVAYPNPHRWAYSNIWGAVCFLKDKKKH
SMYFRIVDLMSNRGVIWEQELYDGFELEMATQFFYTFPGDEYMIGLSFTDTTDASVFYTK
VRTREGSVKTAPKKKKKDNGKKPKGKLDKTQIGLPSGFRHLGHIGYTPENGFSVQNTDPE
WNGLFDQLQSLGISADEINENADFIKDFVNQRGGPEVPTNQQNNSAKARTAPPPPPPVRR
TAPPPPPPIGGRRPPPPPPPSRRAAPQPPAPPIRPSTSNHVSPPPPAPTRVPLPSRTVAP
ATQLPPPPPPTRGIPPPAPVRSTEQPRIPPLETNYQPKKSNNPYRMAEPPATHSFENTYE
EAAETHHQPHSHEEYSHEEEEEEYEHENAYTAHQPSHISSSSPPPPPPPPPPPQQQQQQP
PQRSPPQSAPPQRALPPPVPPLPSGRLSARPSAPPPPPLPNRGRGGPPPPPPAGPRPTAR
SISSRPAMPSPASSMNEQFFDASESFQAGPPPPPPPPPPPPQQSHPNPPQSSGPPPPPPP
PPPGGGPPPPPPPPPSSSGGGPPPPPPPPSQTSAPSNAPATGEPRNALLDAIRRAGGISA
LKAAPRDAIHDRSSPMEGTKSSATAAGGTVGGAGANDLATSLLAALQDRKKAIESDDSDS
EGSDWDDDP
Download sequence
Identical sequences jgi|Phybl1|80145|estExt_fgeneshPB_pg.C_440067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]