SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CCA13931 from Albugo laibachii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCA13931
Domain Number 1 Region: 3-554
Classification Level Classification E-value
Superfamily SIS domain 2.09e-178
Family Phosphoglucose isomerase, PGI 0.000000000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CCA13931
Sequence length 555
Comment pep:novel supercontig:ENA1:FR824046:186664:188379:1 gene:ALNC14_000740 transcript:CCA13931 description:""
Sequence
MISDTLIWKQLQEHANLIKNTTHLRELLKDEDRAEAFRTEHGKIVLDYGRQNATMETAEL
LFALANEAKLREKITAITSGAHVNATEDRAVSHMALRYPADKELIVDGINIVQEVHHVLR
AVKAFSDSVRSGEHKGATGKHLKNVISVGIGGSYLGPEFVYEALRYENNAHTAANGRILR
FLANVDPVDVARATEGLNPEETLVVVVSKTFTTAETMLNARTLRKWLVDSLTAKGVTASD
AVDKHIVAVSAAIPKVKEFGINAKNIFGFWDWVGGRYSVTSAVGILPLALQYGFGVMSEF
LSGAHNMDMHFVHAPFHSNIPVLMGLFGIWNATFLGHSSRALLPYSQALVRFAAHIQQVD
MESNGKRVSVEGIDLPFCTGEINFGEPGTNGQHSFYQLIHQGRIVPCDFIGFTESQKPIA
HADEAVSNHDELMSNFFAQPDALAYGKSISELEKEGVPKALQPHRYFPGNRPSLSLLFEK
LDPFSCGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRNQLEGSRKHQAKIEG
FNPSTSYLLNRYLNH
Download sequence
Identical sequences F0VYR7
CCA13931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]