SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CCA19089 from Albugo laibachii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCA19089
Domain Number 1 Region: 372-740
Classification Level Classification E-value
Superfamily SIS domain 3.39e-68
Family double-SIS domain 0.00000648
Further Details:      
 
Domain Number 2 Region: 106-339
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.89e-57
Family Class II glutamine amidotransferases 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CCA19089
Sequence length 741
Comment pep:novel supercontig:ENA1:FR824108:42461:44743:1 gene:ALNC14_052320 transcript:CCA19089 description:"glutaminefructose6phosphate transaminase putative"
Sequence
MIRQFGGRSSTRITSAVSNAFGSKGISLNRNLFQSSSILFYKIHFDSSNRSFNEGGAKPT
TSKFLKAHHAIIGFLLAAGISSQYDDKQKMSDKHHTSLFGRVAECCGIMGVVGNSENASN
FLLEGVTILQNRGYDSAGMSTQKSVPDKNGQAPITTTKFASVDGTADSIQLLRNSKDQHD
GNNVGIAHTRWATHGSKTDHNAHPHMDMHGRVSVIHNGTFTNYNEIKQELASEGVIFASD
TDTEVAAQLVGHLMGDGADVLTATRLALSRLEGTWGLCIMARDEPGKIIVARNGSPLCIG
YGSNEMYVASETTAFSRYTKRFISLKDGELAVLKSDSAELNPVDEKEGFLQRFPTSRYAT
APDVKVRLAPTPYPHWTIREIMEQPKAVAAALGYGGRVSVDHVYLGGLEAEKERMLKIEN
LLIAACGTSLYASKYGAKLMRSLNAFDNVSAEDASECTPDRLPRKKAGVLVVSQSGETLD
AVRVLKMVEDSPVELPTFSVVNTVGSLIARTTKCGVYLNAGRENAVASTKAFVTQVTVMG
LIACWFAQNRPEGNHTKMDELIQSMHRLPIAIGIALRTRQQCEQVAEILMGSEHLFVLGR
GYGEPIAYEGALKIKELTYLHAEGYPGGALKHGPFALIENAKDGKNGATPIILIVLDDEH
AQYMKTAALEVRARGAHTIVITDNPKMCEGISDTIISIPTNGPMTALLASVPLQLIAYTL
AVKRGINPDVPRNLAKAVTVD
Download sequence
Identical sequences F0WD17
CCA19089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]