SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CCA19808 from Albugo laibachii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCA19808
Domain Number 1 Region: 336-467
Classification Level Classification E-value
Superfamily Chaperone J-domain 9.67e-25
Family Chaperone J-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 14-114
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000765
Family DIX domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CCA19808
Sequence length 473
Comment pep:novel supercontig:ENA1:FR824124:54473:55894:1 gene:ALNC14_059510 transcript:CCA19808 description:"conserved hypothetical protein"
Sequence
MTTSSPATNALWAFYYIQGEDGEDRSHPNAFKVPYSSSSDITLADIHRYFPLKNSSEFHF
RFRLNTHIRGAPGSDHNGKNPPSSKHTFFWLDITSVKQKVPLSNGRVICKLLRLDRPQRI
GLIFQRKPISIQTSIQKEAKETPGSRANSLEKAVRLSEYAEAERRGAYDQPGAPYEEVHA
PSKRDENSSQEPSTNKVPVEKTARKNPTSNESFEDFLSGGGPGKSSTGAGNHENNVNLMN
DHAWSQEGSASNMPRSPTSPKFRSAMDPLAQTKTTQNMNPAAAKTQAPPAFDDDGGQTVG
PVTLAEMRKFATSTSDGSNVYNSSLIDKSTKSEFVRRAMEERERKMHEEITKARQALQQR
EEAQRLLSIQKEQAYITIGPKLKAWAEDNGRTKNIRTLLSTMHQVMWENSKWQEVNMGKL
IQPLDVKKVYRKAMIVVHPDKSRGCNAEELLIAERVFAAVNTAWEEFIATNPC
Download sequence
Identical sequences F0WF26
CCA19808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]