SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000005259 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000005259
Domain Number - Region: 178-229
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0392
Family Intermediate filament protein, coiled coil region 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000005259   Gene: ENSG00000075790   Transcript: ENST00000005259
Sequence length 241
Comment pep:known chromosome:GRCh38:7:107579977:107621870:1 gene:ENSG00000075790 transcript:ENST00000005259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLI
VLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRL
VTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKL
VEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKR
L
Download sequence
Identical sequences E9PAJ1 G3SAF0 Q9UHQ4
NP_061332.2.87134 NP_061332.2.92137 XP_004046074.1.27298 XP_008961817.1.60992 gi|56549091|ref|NP_061332.2| ENSP00000005259 ENSP00000368412 ENSP00000005259 ENSP00000368412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]