SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000009530 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000009530
Domain Number 1 Region: 134-208
Classification Level Classification E-value
Superfamily Class II MHC-associated invariant chain ectoplasmic trimerization domain 2.09e-34
Family Class II MHC-associated invariant chain ectoplasmic trimerization domain 0.00000469
Further Details:      
 
Domain Number 2 Region: 184-275
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.06e-23
Family Thyroglobulin type-1 domain 0.00000955
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000009530   Gene: ENSG00000019582   Transcript: ENST00000009530
Sequence length 296
Comment pep:known chromosome:GRCh38:5:150402152:150412751:-1 gene:ENSG00000019582 transcript:ENST00000009530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLL
LAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPM
GALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKV
FESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLP
LQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Download sequence
Identical sequences P04233
ENSP00000009530 9606.ENSP00000009530 NP_001020330.1.87134 NP_001020330.1.92137 gi|68448544|ref|NP_001020330.1| ENSP00000009530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]